PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_2CD01D459.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 219aa    MW: 24414.6 Da    PI: 10.623
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_2CD01D459.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.6e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd  lv  +kq+G  tW++ ++  g+ R++k+c++rw +yl
  Traes_6DL_2CD01D459.1 14 RGPWTAEEDMTLVAHIKQHGHSTWRALPKQAGLLRCGKSCRLRWINYL 61
                           89******************************99************97 PP

2Myb_DNA-binding482.9e-1567112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE++ ++++ ++lG++ W+tIa++++ gRt++++k+ w+++l
  Traes_6DL_2CD01D459.1  67 RGNFTSEEEDAIIQLDAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 112
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129413.491961IPR017930Myb domain
SuperFamilySSF466899.54E-2911108IPR009057Homeodomain-like
SMARTSM007174.7E-121363IPR001005SANT/Myb domain
PfamPF002494.4E-141461IPR001005SANT/Myb domain
CDDcd001675.10E-101661No hitNo description
PROSITE profilePS5129423.93662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-2565116IPR009057Homeodomain-like
SMARTSM007177.2E-1266114IPR001005SANT/Myb domain
PfamPF002492.3E-1367112IPR001005SANT/Myb domain
CDDcd001672.42E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MGRSPCCEKT GIKRGPWTAE EDMTLVAHIK QHGHSTWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TSEEEDAIIQ LDAMLGNRWS TIAARLPGRT DNEIKNVWHT HLKKRLDSSS  120
SKTSGQASPK RKAEKPAVAA STLEDPTSDP VSPEQSLSTS SATDYSMASS LNTGSLGRVP  180
DRRQLLVGDT CDVGGQLRFR DGNQRHLRRR SRIAVVEQR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141187110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0116870.0GU011687.1 Leymus multicaulis MYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.17e-94PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-73MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW5GV461e-162W5GV46_WHEAT; Uncharacterized protein
STRINGMLOC_34646.11e-107(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.19e-74myb domain protein 15
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]